Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Vibrio cyclitrophicus [TaxId:47951] [384017] (1 PDB entry) |
Domain d6m4ja_: 6m4j A: [384021] automated match to d3vaxa_ complexed with cys, plp |
PDB Entry: 6m4j (more details), 1.8 Å
SCOPe Domain Sequences for d6m4ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m4ja_ c.67.1.0 (A:) automated matches {Vibrio cyclitrophicus [TaxId: 47951]} tkyfdyaastpvakgvlesmkpwqsdsfanpsaahieaekalnaikqareiiadtlgamp seivftcgasesnnlaikglafkrleekghlitssiehkcvlntcgflesigfdvtyltp kasglisaqqveeairpntflitihhvnnelgtvqpiedignvafehdipfhtdaaqsfc kldidvddmnidmlslsghkvygpkgigalyvrdarnselvplihgggqelglrggtspt plivglgvavehfpseasaqqtefekiineysfsrnsgdnalsttwnvtfenddevkrft sernwlisqgsasnamsntpshvltaiglseaearrtyrislppykv
Timeline for d6m4ja_: