SCOPe 2.07: Domain d6m4ja_: 6m4j A:

Lineage for d6m4ja_ (6m4j A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Vibrio cyclitrophicus [TaxId:47951] [384017] (1 PDB entry)

8. Domain d6m4ja_: 6m4j A: [384021]
   automated match to d3vaxa_
   complexed with cys, plp

Details for d6m4ja_

PDB Entry: 6m4j, 1.8 Å

PDB Description: sspa in complex with cysteine

PDB Compounds: (A:) SspA complex protein

SCOPe Domain Sequences for d6m4ja_:

Sequence; same for both SEQRES and ATOM records:

>d6m4ja_ c.67.1.0 (A:) automated matches {Vibrio cyclitrophicus [TaxId: 47951]}
tkyfdyaastpvakgvlesmkpwqsdsfanpsaahieaekalnaikqareiiadtlgamp
seivftcgasesnnlaikglafkrleekghlitssiehkcvlntcgflesigfdvtyltp
kasglisaqqveeairpntflitihhvnnelgtvqpiedignvafehdipfhtdaaqsfc
kldidvddmnidmlslsghkvygpkgigalyvrdarnselvplihgggqelglrggtspt
plivglgvavehfpseasaqqtefekiineysfsrnsgdnalsttwnvtfenddevkrft
sernwlisqgsasnamsntpshvltaiglseaearrtyrislppykv

Timeline for d6m4ja_:

• d6m4ja_ is new in SCOPe 2.07-stable
  
• d6m4ja_ appears in the current release, SCOPe 2.08