Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) |
Superfamily d.26.1: FKBP-like [54534] (2 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (5 proteins) |
Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54537] (28 PDB entries) |
Domain d1d7ha_: 1d7h A: [38398] |
PDB Entry: 1d7h (more details), 1.9 Å
SCOP Domain Sequences for d1d7ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7ha_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)} gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
Timeline for d1d7ha_: