SCOPe 2.07: Domain d6vvma2: 6vvm A:64-123

Lineage for d6vvma2 (6vvm A:64-123)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.0: automated matches [191533] (1 protein)
   not a true family

6. Protein automated matches [190903] (22 species)
   not a true protein

7. Species Burkholderia sp. [TaxId:758796] [383818] (1 PDB entry)

8. Domain d6vvma2: 6vvm A:64-123 [383926]
   automated match to d6blma2

Details for d6vvma2

PDB Entry: 6vvm, 1.83 Å

PDB Description: r7 fused 4-ot wild type asymmetric trimer

PDB Compounds: (A:) 4-oxalocrotonate tautomerase family enzyme

SCOPe Domain Sequences for d6vvma2:

Sequence; same for both SEQRES and ATOM records:

>d6vvma2 d.80.1.0 (A:64-123) automated matches {Burkholderia sp. [TaxId: 758796]}
iiailiagrteaqkealiahlsetsasvldvslqstrvmikdipntdfglggktaralgr

Timeline for d6vvma2:

• d6vvma2 is new in SCOPe 2.07-stable
  
• d6vvma2 appears in the current release, SCOPe 2.08