Lineage for d6uted1 (6ute D:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2369149Domain d6uted1: 6ute D:1-106 [383898]
    Other proteins in same PDB: d6uteb2, d6uted2, d6utef2, d6uteh2, d6utej2, d6utes_
    automated match to d1dn0a1
    complexed with gol

Details for d6uted1

PDB Entry: 6ute (more details), 2.9 Å

PDB Description: crystal structure of z032 fab in complex with wnv ediii
PDB Compounds: (D:) Z032 Fab light chain

SCOPe Domain Sequences for d6uted1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uted1 b.1.1.0 (D:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspstlsasvgdrvnitcrasqsinqwlawyqqkpgkapkflmykastletgvps
rfsgsgsgteftltisslqpddfatyycqhyfsypwtfgqgtkvei

SCOPe Domain Coordinates for d6uted1:

Click to download the PDB-style file with coordinates for d6uted1.
(The format of our PDB-style files is described here.)

Timeline for d6uted1: