Lineage for d6ylae_ (6yla E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616505Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 2616506Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
    automatically mapped to Pfam PF09408
  5. 2616507Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
    part of PfamB PB000266
  6. 2616508Protein Spike protein S1 [143589] (4 species)
  7. 2616541Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382292] (92 PDB entries)
  8. 2616629Domain d6ylae_: 6yla E: [383862]
    Other proteins in same PDB: d6ylac1, d6ylac2, d6ylal1, d6ylal2
    automated match to d2dd8s1
    complexed with 1pe, dms, mli, nag, pg0

Details for d6ylae_

PDB Entry: 6yla (more details), 2.42 Å

PDB Description: crystal structure of the sars-cov-2 receptor binding domain in complex with cr3022 fab
PDB Compounds: (E:) SARS-CoV-2 RBD

SCOPe Domain Sequences for d6ylae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ylae_ d.318.1.1 (E:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
etgpnitnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptk
lndlcftnvyadsfvirgdevrqiapgqtgkiadynyklpddftgcviawnsnnldskvg
gnynylyrlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyq
pyrvvvlsfellhapatvcgpkk

SCOPe Domain Coordinates for d6ylae_:

Click to download the PDB-style file with coordinates for d6ylae_.
(The format of our PDB-style files is described here.)

Timeline for d6ylae_:

  • d6ylae_ is new in SCOPe 2.07-stable
  • d6ylae_ appears in the current release, SCOPe 2.08, called d6ylae1