Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily) core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542 |
Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) automatically mapped to Pfam PF09408 |
Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein) part of PfamB PB000266 |
Protein Spike protein S1 [143589] (4 species) |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382292] (92 PDB entries) |
Domain d6ylae_: 6yla E: [383862] Other proteins in same PDB: d6ylac1, d6ylac2, d6ylal1, d6ylal2 automated match to d2dd8s1 complexed with 1pe, dms, mli, nag, pg0 |
PDB Entry: 6yla (more details), 2.42 Å
SCOPe Domain Sequences for d6ylae_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ylae_ d.318.1.1 (E:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} etgpnitnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptk lndlcftnvyadsfvirgdevrqiapgqtgkiadynyklpddftgcviawnsnnldskvg gnynylyrlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyq pyrvvvlsfellhapatvcgpkk
Timeline for d6ylae_: