Lineage for d1fkda_ (1fkd A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1644292Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1644293Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1644294Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1644305Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 1644309Species Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries)
  8. 1644316Domain d1fkda_: 1fkd A: [38383]
    complexed with 818

Details for d1fkda_

PDB Entry: 1fkd (more details), 1.72 Å

PDB Description: fk-506 binding protein: three-dimensional structure of the complex with the antagonist l-685,818
PDB Compounds: (A:) fk506 binding protein

SCOPe Domain Sequences for d1fkda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkda_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOPe Domain Coordinates for d1fkda_:

Click to download the PDB-style file with coordinates for d1fkda_.
(The format of our PDB-style files is described here.)

Timeline for d1fkda_: