SCOPe 2.07: Domain d6vvnc2: 6vvn C:62-123

Lineage for d6vvnc2 (6vvn C:62-123)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.0: automated matches [191533] (1 protein)
   not a true family

6. Protein automated matches [190903] (22 species)
   not a true protein

7. Species Caballeronia arationis [TaxId:1777142] [383812] (1 PDB entry)

8. Domain d6vvnc2: 6vvn C:62-123 [383829]
   automated match to d1otfa_
   complexed with gol

Details for d6vvnc2

PDB Entry: 6vvn, 1.39 Å

PDB Description: f6 fused 4-ot wild type asymmetric trimer

PDB Compounds: (C:) 4-oxalocrotonate tautomerase

SCOPe Domain Sequences for d6vvnc2:

Sequence; same for both SEQRES and ATOM records:

>d6vvnc2 d.80.1.0 (C:62-123) automated matches {Caballeronia arationis [TaxId: 1777142]}
pviiailiagrtdaqkkaliaqlsetiaavldaplqstrvmikdipntdfgiggqtaral
gr

Timeline for d6vvnc2:

• d6vvnc2 is new in SCOPe 2.07-stable
  
• d6vvnc2 appears in the current release, SCOPe 2.08