Lineage for d6rkla_ (6rkl A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2522921Species Geobacillus stearothermophilus [TaxId:1422] [225397] (10 PDB entries)
  8. 2522931Domain d6rkla_: 6rkl A: [383769]
    automated match to d1eu8a_
    complexed with ahr, ca, gol

Details for d6rkla_

PDB Entry: 6rkl (more details), 2 Å

PDB Description: the crystal structure of abne, an arabino-oligosaccharide binding protein, in complex with arabinoheptaose
PDB Compounds: (A:) Arabino-oligosaccharids-binding protein

SCOPe Domain Sequences for d6rkla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rkla_ c.94.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
kieltfmfrgqpqeqtayknvvkkfeekhpnvkvnivvtspdqyatklraaiagrkipdv
fyfnpgelrayvnsnvllditkyvenskgvnlqdiwekgvnkyrfdgekvgqgnlyglpk
dlgpfalgynktmfekagiplpdkdkpytwqefidvckkltkdtngdgkldqwgtglnat
wtlqgfvwsngadwidesktkvtvddpkfiealqffadmqnkykvtpsiaeaqtldtyqr
wlrgqlgffpvgpwdlaafdqqikfeydlipwpagstgkpatwvgslgigvssmtkhpke
avelalylsadpegqkalvdqrvqlpnsvkvaeewakdpsikpankqefldiindyghsf
pteytyngewydefyrnlqpvldgkmsaeeyvkkakpkmqklldqaieqekqask

SCOPe Domain Coordinates for d6rkla_:

Click to download the PDB-style file with coordinates for d6rkla_.
(The format of our PDB-style files is described here.)

Timeline for d6rkla_: