Lineage for d6ojoa_ (6ojo A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2572796Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2572797Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2573513Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2573514Protein automated matches [227009] (15 species)
    not a true protein
  7. 2573646Species Yersinia pestis [TaxId:632] [311332] (2 PDB entries)
  8. 2573647Domain d6ojoa_: 6ojo A: [383643]
    automated match to d2o9ma_
    complexed with pe0

Details for d6ojoa_

PDB Entry: 6ojo (more details), 1.89 Å

PDB Description: dihydroneopterin aldolase (dhna) from yersinia pestis co-crystallized with pterine
PDB Compounds: (A:) 7,8-dihydroneopterin aldolase

SCOPe Domain Sequences for d6ojoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ojoa_ d.96.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
mdivfieelsvittigvydweqtiqqklvfdiemgwdnrkaagsddvndclsyadiseav
iqhvgsqrfalvervaeevaelllrrfnspwvrikvskpgavaqaknvgviiergqrl

SCOPe Domain Coordinates for d6ojoa_:

Click to download the PDB-style file with coordinates for d6ojoa_.
(The format of our PDB-style files is described here.)

Timeline for d6ojoa_: