Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
Protein automated matches [227009] (15 species) not a true protein |
Species Yersinia pestis [TaxId:632] [311332] (2 PDB entries) |
Domain d6ojoa_: 6ojo A: [383643] automated match to d2o9ma_ complexed with pe0 |
PDB Entry: 6ojo (more details), 1.89 Å
SCOPe Domain Sequences for d6ojoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ojoa_ d.96.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]} mdivfieelsvittigvydweqtiqqklvfdiemgwdnrkaagsddvndclsyadiseav iqhvgsqrfalvervaeevaelllrrfnspwvrikvskpgavaqaknvgviiergqrl
Timeline for d6ojoa_: