SCOPe 2.07: Domain d6xuab1: 6xua B:0-131

Lineage for d6xuab1 (6xua B:0-131)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187833] (50 PDB entries)

8. Domain d6xuab1: 6xua B:0-131 [383542]
   Other proteins in same PDB: d6xuab2
   automated match to d1vyfa_
   complexed with cit, plm; mutant

Details for d6xuab1

PDB Entry: 6xua, 2.3 Å

PDB Description: human myelin protein p2 mutant k21q

PDB Compounds: (B:) myelin p2 protein

SCOPe Domain Sequences for d6xuab1:

Sequence; same for both SEQRES and ATOM records:

>d6xuab1 b.60.1.0 (B:0-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msnkflgtwklvssenfddymqalgvglatrklgnlakptviiskkgdiitirtestfkn
teisfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeckm
kgvvctriyekv

Timeline for d6xuab1:

• d6xuab1 is new in SCOPe 2.07-stable
  
• d6xuab1 appears in the current release, SCOPe 2.08