SCOPe 2.07: Domain d6txzm2: 6txz M:110-211

Lineage for d6txzm2 (6txz M:110-211)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d6txzm2: 6txz M:110-211 [383519]
Other proteins in same PDB: d6txza_, d6txzb_, d6txzc_, d6txzd_, d6txzl1, d6txzm1, d6txzn1, d6txzo1
automated match to d1aqkl2

Details for d6txzm2

PDB Entry: 6txz (more details), 3.06 Å

PDB Description: fab part of m6903 in complex with human tim3

PDB Compounds: (M:) Fab L

SCOPe Domain Sequences for d6txzm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6txzm2 b.1.1.2 (M:110-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapt

SCOPe Domain Coordinates for d6txzm2:

Click to download the PDB-style file with coordinates for d6txzm2.
(The format of our PDB-style files is described here.)

Timeline for d6txzm2: