SCOPe 2.07: Domain d6wctc_: 6wct C:

Lineage for d6wctc_ (6wct C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Stenotrophomonas maltophilia [TaxId:522373] [383487] (1 PDB entry)

8. Domain d6wctc_: 6wct C: [383496]
   automated match to d3lnca_
   complexed with 5gp, edo, po4

Details for d6wctc_

PDB Entry: 6wct, 2.1 Å

PDB Description: crystal structure of a guanylate kinase from stenotrophomonas maltophilia k279a bound to guanosine-5'-monophosphate

PDB Compounds: (C:) Guanylate kinase

SCOPe Domain Sequences for d6wctc_:

Sequence, based on SEQRES records:

>d6wctc_ c.37.1.0 (C:) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]}
argtlyivaapsgagkssivnatlardpqialsisftsramrpgevngqhyhfvsaekfe
qmiaagdffehawvhgdwkgtarqsvepqlaagqdvlleidwqgaqqvrqlvpgtvtvfi
lppskqalqdrmrkrgqdseaviaqrlgaardemlhfnefdyvivnevfdtavdelcaif
tasrlrreaqkvrhagliqalltpd

Sequence, based on observed residues (ATOM records):

>d6wctc_ c.37.1.0 (C:) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]}
argtlyivaapsgagkssivnatlardpqialsisftsramrpgevngqhyhfvsaekfe
qmiaagdffehawvhgdwkgtarqsvepqlaagqdvlleidwqgaqqvrqlvpgtvtvfi
lppskqalqdrmseaviaqrlgaardemlhfnefdyvivnevfdtavdelcaiftasrlr
reaqkvrhagliqalltpd

Timeline for d6wctc_:

• d6wctc_ is new in SCOPe 2.07-stable
  
• d6wctc_ appears in the current release, SCOPe 2.08