Lineage for d6jrqa_ (6jrq A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2481071Species Thermus thermophilus [TaxId:300852] [272710] (20 PDB entries)
  8. 2481100Domain d6jrqa_: 6jrq A: [383462]
    automated match to d4m9da_
    complexed with edo, imp

Details for d6jrqa_

PDB Entry: 6jrq (more details), 2.1 Å

PDB Description: crystal structure of adenylosuccinate synthetase, pura, from thermus thermophilus
PDB Compounds: (A:) adenylosuccinate synthetase

SCOPe Domain Sequences for d6jrqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jrqa_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
pgiaiigaqwgdegkgkvvdvlareadyviryqgganaghtvvaegkvfklnllpsgvih
phavnvlgdgmvidpfrfqeeveglrkegfdpkilvserahlvlphhkhvesrhnfvgtt
grgigpaysdrarrvgiragdlldeatlrervrrllaekpnstreagwdteekaladlhr
mreilspyiadtgsllreawrkgkrllfegaqatlldlnygtypyvtsshptvggilvgt
glshkaitkvygvakayttrvgegpfptelqgelahhlrekggeygtttgrprrvgwldl
valryacevngfdglvltkldvlsglekvkvaveyldgarpgeaspeavrylelpgwgdl
shvkrredlpanllrylelveehtgvpvvlfstsprredtfgavswv

SCOPe Domain Coordinates for d6jrqa_:

Click to download the PDB-style file with coordinates for d6jrqa_.
(The format of our PDB-style files is described here.)

Timeline for d6jrqa_: