Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.8: Rv2717c-like [141475] (3 proteins) bacterial and plant proteins with a fatty acid binding protein-like fold automatically mapped to Pfam PF08768 |
Protein Hypothetical protein Rv2717c [141476] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [141477] (3 PDB entries) Uniprot O07216 4-164 |
Domain d6r3wa_: 6r3w A: [383440] automated match to d2fr2a1 complexed with hem |
PDB Entry: 6r3w (more details), 1.2 Å
SCOPe Domain Sequences for d6r3wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6r3wa_ b.60.1.8 (A:) Hypothetical protein Rv2717c {Mycobacterium tuberculosis [TaxId: 1773]} dlapalqalspllgswagrgagkyptirpfeyleevvfahvgkpfltytqqtravadgkp lhsetgylrvcrpgcvelvlahpsgiteievgtysvtgdvielelstradgsiglaptak evtaldrsyridgdelsyslqmravgqplqdhlaavlhrqr
Timeline for d6r3wa_: