Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) |
Family c.84.1.0: automated matches [254314] (1 protein) not a true family |
Protein automated matches [254721] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [316254] (15 PDB entries) |
Domain d6snoa2: 6sno A:210-322 [383405] Other proteins in same PDB: d6snoa4 automated match to d5epca2 complexed with g1p, zn |
PDB Entry: 6sno (more details), 2.7 Å
SCOPe Domain Sequences for d6snoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6snoa2 c.84.1.0 (A:210-322) automated matches {Human (Homo sapiens) [TaxId: 9606]} veayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv
Timeline for d6snoa2: