Lineage for d6jsta_ (6jst A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442704Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2442705Protein automated matches [190150] (34 species)
    not a true protein
  7. 2442801Species Geobacillus kaustophilus [TaxId:235909] [383298] (3 PDB entries)
  8. 2442802Domain d6jsta_: 6jst A: [383344]
    automated match to d3e3ha_
    complexed with fe, lae, oh, zn; mutant

Details for d6jsta_

PDB Entry: 6jst (more details), 1.73 Å

PDB Description: structure of geobacillus kaustophilus lactonase, y99p/d266n double mutant with bound 3-oxo-c8-hsl
PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d6jsta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jsta_ c.1.9.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
emvetvcgpvpveqlgktlihehflfgypgfqgdvtrgtfredeslrvaveaaekmkrhg
iqtvvdptpndcgrnpaflrrvaeetglniicatgypyegegappyfqfrrllgtaeddi
ydmfmaeltegiadtgikagviklasskgriteyekmffraaaraqketgaviithtqeg
tmgpeqaayllehgadpkkivighmcgntdpdyhrktlaygvyiafdrfgiqgmvgaptd
eervrtllallrdgyekqimlshntvnvwlgrpftlpepfaemmknwhvehlfvniipal
knegirdevleqmfignpaalfs

SCOPe Domain Coordinates for d6jsta_:

Click to download the PDB-style file with coordinates for d6jsta_.
(The format of our PDB-style files is described here.)

Timeline for d6jsta_: