SCOPe 2.07: Domain d6ka6b2: 6ka6 B:229-582

Lineage for d6ka6b2 (6ka6 B:229-582)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:5843] [354075] (9 PDB entries)

8. Domain d6ka6b2: 6ka6 B:229-582 [383307]
   Other proteins in same PDB: d6ka6a1, d6ka6b1, d6ka6c1, d6ka6d1
   automated match to d3bjua2
   protein/RNA complex; complexed with d4o, gol, lys

Details for d6ka6b2

PDB Entry: 6ka6, 1.89 Å

PDB Description: crystal structure of plasmodium lysyl-trna synthetase in complex with a cladosporin derivative 1

PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6ka6b2:

Sequence; same for both SEQRES and ATOM records:

>d6ka6b2 d.104.1.0 (B:229-582) automated matches {Plasmodium falciparum [TaxId: 5843]}
dteiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnliagganar
pfithhndldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefy
wayadyndlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeie
kvtntileqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffi
vehpqimsplakyhrtkpglterlemficgkevlnaytelndpfkqkecfklqqkdrekg
dteaaqldsafctsleyglpptgglglgidritmfltnknsikdvilfptmrpa

Timeline for d6ka6b2:

• d6ka6b2 is new in SCOPe 2.07-stable
  
• d6ka6b2 appears in the current release, SCOPe 2.08