Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [383243] (1 PDB entry) |
Domain d6rjia2: 6rji A:64-127 [383244] Other proteins in same PDB: d6rjia1 automated match to d1ueba2 |
PDB Entry: 6rji (more details), 1.48 Å
SCOPe Domain Sequences for d6rjia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rjia2 b.40.4.0 (A:64-127) automated matches {Staphylococcus aureus [TaxId: 93061]} mienrrmqylyadgdnhvfmdnesfeqtelssdylkeelnylkegmevqiqtyegetigv elpk
Timeline for d6rjia2: