Lineage for d6lcqa1 (6lcq A:1-49)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635705Family g.3.7.0: automated matches [335175] (1 protein)
    not a true family
  6. 2635706Protein automated matches [335176] (4 species)
    not a true protein
  7. 2635709Species Oryza sativa [TaxId:4530] [383132] (1 PDB entry)
  8. 2635710Domain d6lcqa1: 6lcq A:1-49 [383133]
    Other proteins in same PDB: d6lcqa2, d6lcqb2
    automated match to d5ncea_
    complexed with po4

Details for d6lcqa1

PDB Entry: 6lcq (more details), 1.62 Å

PDB Description: crystal structure of rice defensin osafp1
PDB Compounds: (A:) Defensin-like protein CAL1

SCOPe Domain Sequences for d6lcqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lcqa1 g.3.7.0 (A:1-49) automated matches {Oryza sativa [TaxId: 4530]}
rhclsqshrfkgmcvssnncanvcrtesfpdgeckshglerkcfckkvc

SCOPe Domain Coordinates for d6lcqa1:

Click to download the PDB-style file with coordinates for d6lcqa1.
(The format of our PDB-style files is described here.)

Timeline for d6lcqa1:

2635710
d6lcqa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6lcqa2