SCOPe 2.07: Domain d6r78a_: 6r78 A:

Lineage for d6r78a_ (6r78 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [271524] (10 PDB entries)

8. Domain d6r78a_: 6r78 A: [383116]
   automated match to d4ubqa_
   complexed with bme, edo, gol, na, peg, zn

Details for d6r78a_

PDB Entry: 6r78, 2.21 Å

PDB Description: structure of imp-13 metallo-beta-lactamase in apo form (loop closed)

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6r78a_:

Sequence; same for both SEQRES and ATOM records:

>d6r78a_ d.157.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
lpdlkiekleegvfvhtsfeevngwgvvtkhglvvlvntdaylidtpftatdteklvnwf
vergyeikgtisshfhsdstggiewlnsqsiptyaseltnellkksgkvqakysfsevsy
wlvknkievfypgpghtqdnlvvwlpeskilfggcfikphglgnlgdanleawpksakil
mskygkaklvvsshsekgdaslmkrtweqalkglkesk

Timeline for d6r78a_:

• d6r78a_ is new in SCOPe 2.07-stable
  
• d6r78a_ appears in the current release, SCOPe 2.08