Lineage for d6r1la_ (6r1l A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308239Species Lactococcus lactis [TaxId:416870] [188710] (8 PDB entries)
  8. 2308245Domain d6r1la_: 6r1l A: [383107]
    automated match to d3f8fa_
    complexed with cu, phn

Details for d6r1la_

PDB Entry: 6r1l (more details), 2.1 Å

PDB Description: crystal structure of lmrr with bound copper phenanthroline
PDB Compounds: (A:) Transcriptional regulator, PadR-like family

SCOPe Domain Sequences for d6r1la_:

Sequence, based on SEQRES records: (download)

>d6r1la_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]}
pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
sywgdesqggrrkyyrlteighenmrlafeswsrvdkiienlea

Sequence, based on observed residues (ATOM records): (download)

>d6r1la_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]}
pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
sywgdgrrkyyrlteighenmrlafeswsrvdkiienlea

SCOPe Domain Coordinates for d6r1la_:

Click to download the PDB-style file with coordinates for d6r1la_.
(The format of our PDB-style files is described here.)

Timeline for d6r1la_: