Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Lactococcus lactis [TaxId:416870] [188710] (8 PDB entries) |
Domain d6r1la_: 6r1l A: [383107] automated match to d3f8fa_ complexed with cu, phn |
PDB Entry: 6r1l (more details), 2.1 Å
SCOPe Domain Sequences for d6r1la_:
Sequence, based on SEQRES records: (download)
>d6r1la_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]} pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis sywgdesqggrrkyyrlteighenmrlafeswsrvdkiienlea
>d6r1la_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]} pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis sywgdgrrkyyrlteighenmrlafeswsrvdkiienlea
Timeline for d6r1la_: