Class g: Small proteins [56992] (98 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (3 families) |
Family g.14.1.0: automated matches [254254] (1 protein) not a true family |
Protein automated matches [254580] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255350] (15 PDB entries) |
Domain d6oshk_: 6osh K: [383074] Other proteins in same PDB: d6oshh_, d6oshl_ automated match to d1pk2a_ |
PDB Entry: 6osh (more details), 1.12 Å
SCOPe Domain Sequences for d6oshk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6oshk_ g.14.1.0 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hqcyngsgmdyrgtasttksghqcqpwalqhphshhlsstdfpelggghaycrnpggqme gpwcftqnknvrmelcdvpsc
Timeline for d6oshk_: