Lineage for d6oshk_ (6osh K:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638013Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2638014Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2638226Family g.14.1.0: automated matches [254254] (1 protein)
    not a true family
  6. 2638227Protein automated matches [254580] (2 species)
    not a true protein
  7. 2638228Species Human (Homo sapiens) [TaxId:9606] [255350] (15 PDB entries)
  8. 2638231Domain d6oshk_: 6osh K: [383074]
    Other proteins in same PDB: d6oshh_, d6oshl_
    automated match to d1pk2a_

Details for d6oshk_

PDB Entry: 6osh (more details), 1.12 Å

PDB Description: potent and selective antitumor antibody targeting a membrane-proximal epitope of ror2
PDB Compounds: (K:) tyrosine-protein kinase transmembrane receptor ror2

SCOPe Domain Sequences for d6oshk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6oshk_ g.14.1.0 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hqcyngsgmdyrgtasttksghqcqpwalqhphshhlsstdfpelggghaycrnpggqme
gpwcftqnknvrmelcdvpsc

SCOPe Domain Coordinates for d6oshk_:

Click to download the PDB-style file with coordinates for d6oshk_.
(The format of our PDB-style files is described here.)

Timeline for d6oshk_: