Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.6: PMT1231-like [158402] (2 proteins) PfamB PB016165 automatically mapped to Pfam PF11266 |
Protein automated matches [261918] (5 species) not a true protein |
Species Synechococcus elongatus [TaxId:1140] [261919] (8 PDB entries) |
Domain d6jzub_: 6jzu B: [383029] automated match to d4quwa_ complexed with fe2, ocd, pl3 |
PDB Entry: 6jzu (more details), 2.18 Å
SCOPe Domain Sequences for d6jzub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jzub_ a.25.1.6 (B:) automated matches {Synechococcus elongatus [TaxId: 1140]} dfqsesykdaysrinaiviegeqeafdnynrlaemlpdqrdelhklakmeqrhmkgfmac gknlsvtpdmgfaqkfferlhenfkaaaaegkvvtclliqsliiecfaiaayniyipvad afarkitegvvrdeylhrnfgeewlkanfdaskaeleeanrqnlplvwlmlnevaddare lgmereslvedfmiaygealenigfttreimrmsaygl
Timeline for d6jzub_: