SCOPe 2.07: Domain d6o8na_: 6o8n A:

Lineage for d6o8na_ (6o8n A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:1061] [383009] (5 PDB entries)

8. Domain d6o8na_: 6o8n A: [383021]
   automated match to d3jtha_
   complexed with so4

Details for d6o8na_

PDB Entry: 6o8n, 1.95 Å

PDB Description: crystal structure of c9s tetrasulfide state of sulfide-responsive transcriptional repressor (sqrr) from rhodobacter capsulatus.

PDB Compounds: (A:) Transcriptional regulator, ArsR family

SCOPe Domain Sequences for d6o8na_:

Sequence; same for both SEQRES and ATOM records:

>d6o8na_ a.4.5.0 (A:) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
eematraraasnllkalahegrlmimcylasgeksvteletrlstrqaavsqqlarlrle
glvqsrregktiyyslsdpraarvvqtvyeqfcsg

Timeline for d6o8na_:

• d6o8na_ is new in SCOPe 2.07-stable
  
• d6o8na_ appears in the current release, SCOPe 2.08