Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein automated matches [190079] (12 species) not a true protein |
Species Escherichia coli [TaxId:562] [382986] (1 PDB entry) |
Domain d6lvjb_: 6lvj B: [382987] automated match to d5ev8c_ complexed with zn |
PDB Entry: 6lvj (more details), 1.83 Å
SCOPe Domain Sequences for d6lvjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lvjb_ d.157.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll kskygkaklvvpghsevgdasllkltleqavkglne
Timeline for d6lvjb_: