Lineage for d6kwyy_ (6kwy Y:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2597201Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2599324Species Human (Homo sapiens) [TaxId:9606] [311421] (14 PDB entries)
  8. 2599386Domain d6kwyy_: 6kwy Y: [382985]
    Other proteins in same PDB: d6kwya_, d6kwyc_, d6kwyd_, d6kwye_, d6kwyf_, d6kwyg_, d6kwyh_, d6kwyi_, d6kwym_, d6kwyo_, d6kwyp_, d6kwyq_, d6kwyr_, d6kwys_, d6kwyt_, d6kwyu_, d6kwyv_, d6kwyw_
    automated match to d1irul_
    complexed with i6p, k0w

Details for d6kwyy_

PDB Entry: 6kwy (more details), 2.72 Å

PDB Description: human pa200-20s complex
PDB Compounds: (Y:) Proteasome subunit beta type-5

SCOPe Domain Sequences for d6kwyy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kwyy_ d.153.1.4 (Y:) Proteasome beta subunit (catalytic) {Human (Homo sapiens) [TaxId: 9606]}
tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr
edgwirvssdnvadlheky

SCOPe Domain Coordinates for d6kwyy_:

Click to download the PDB-style file with coordinates for d6kwyy_.
(The format of our PDB-style files is described here.)

Timeline for d6kwyy_: