Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome beta subunit (catalytic) [56252] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [311421] (14 PDB entries) |
Domain d6kwyy_: 6kwy Y: [382985] Other proteins in same PDB: d6kwya_, d6kwyc_, d6kwyd_, d6kwye_, d6kwyf_, d6kwyg_, d6kwyh_, d6kwyi_, d6kwym_, d6kwyo_, d6kwyp_, d6kwyq_, d6kwyr_, d6kwys_, d6kwyt_, d6kwyu_, d6kwyv_, d6kwyw_ automated match to d1irul_ complexed with i6p, k0w |
PDB Entry: 6kwy (more details), 2.72 Å
SCOPe Domain Sequences for d6kwyy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kwyy_ d.153.1.4 (Y:) Proteasome beta subunit (catalytic) {Human (Homo sapiens) [TaxId: 9606]} tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr edgwirvssdnvadlheky
Timeline for d6kwyy_: