SCOPe 2.07: Domain d6l2eb1: 6l2e B:1-114

Lineage for d6l2eb1 (6l2e B:1-114)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.10: TM1459-like [101976] (3 proteins)

6. Protein automated matches [334958] (1 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [334959] (6 PDB entries)

8. Domain d6l2eb1: 6l2e B:1-114 [382974]
   Other proteins in same PDB: d6l2ea2, d6l2eb2
   automated match to d1vj2a_
   complexed with csd, cu, mes; mutant

Details for d6l2eb1

PDB Entry: 6l2e, 1.2 Å

PDB Description: crystal structure of a cupin protein (tm1459, h52a mutant) in copper (cu) substituted form

PDB Compounds: (B:) Cupin_2 domain-containing protein

SCOPe Domain Sequences for d6l2eb1:

Sequence; same for both SEQRES and ATOM records:

>d6l2eb1 b.82.1.10 (B:1-114) automated matches {Thermotoga maritima [TaxId: 243274]}
milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrashpwehei
fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge

Timeline for d6l2eb1:

• d6l2eb1 is new in SCOPe 2.07-stable
  
• d6l2eb1 appears in the current release, SCOPe 2.08