Lineage for d6kx6b1 (6kx6 B:1-205)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470051Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2470052Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 2470089Family c.28.1.0: automated matches [227292] (1 protein)
    not a true family
  6. 2470090Protein automated matches [227113] (4 species)
    not a true protein
  7. 2470105Species Mouse (Mus musculus) [TaxId:10090] [226619] (17 PDB entries)
  8. 2470120Domain d6kx6b1: 6kx6 B:1-205 [382972]
    Other proteins in same PDB: d6kx6a2, d6kx6b2
    automated match to d4mlpa1
    complexed with dyu

Details for d6kx6b1

PDB Entry: 6kx6 (more details), 2 Å

PDB Description: crystal structure of mouse cryptochrome 1 in complex with kl101 compound
PDB Compounds: (B:) Cryptochrome-1

SCOPe Domain Sequences for d6kx6b1:

Sequence, based on SEQRES records: (download)

>d6kx6b1 c.28.1.0 (B:1-205) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mgvnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcle
dldanlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklatea
gvevivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmt
plsddhdekygvpsleelgfdtdgl

Sequence, based on observed residues (ATOM records): (download)

>d6kx6b1 c.28.1.0 (B:1-205) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mgvnavhwfrkglrlhdnpalkeciqgadtircvyildnvginrwrfllqcledldanlr
klnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagvevivr
ishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmtplsddhd
ekygvpsleelgfdtdgl

SCOPe Domain Coordinates for d6kx6b1:

Click to download the PDB-style file with coordinates for d6kx6b1.
(The format of our PDB-style files is described here.)

Timeline for d6kx6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6kx6b2