Lineage for d6w61b_ (6w61 B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643467Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily)
    binds two zinc ion per subunit; forms a dodecameric shell
  4. 2643468Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) (S)
    automatically mapped to Pfam PF09401
  5. 2643469Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins)
    partly covered by PfamB PB001266
  6. 2643521Protein automated matches [191249] (4 species)
    not a true protein
  7. 2643542Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382496] (24 PDB entries)
  8. 2643555Domain d6w61b_: 6w61 B: [382921]
    automated match to d2xyqb_
    complexed with cl, edo, sam, zn

Details for d6w61b_

PDB Entry: 6w61 (more details), 2 Å

PDB Description: crystal structure of the methyltransferase-stimulatory factor complex of nsp16 and nsp10 from sars cov-2.
PDB Compounds: (B:) Stimulatory factor NSP10

SCOPe Domain Sequences for d6w61b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6w61b_ g.86.1.1 (B:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
afavdaakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfggascclyc
rchidhpnpkgfcdlkgkyvqipttcandpvgftlkntvctvcgmwkgygcscdq

SCOPe Domain Coordinates for d6w61b_:

Click to download the PDB-style file with coordinates for d6w61b_.
(The format of our PDB-style files is described here.)

Timeline for d6w61b_: