Lineage for d2mhaa2 (2mha A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545171Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
    Uniprot P01901 22-299
  8. 2545222Domain d2mhaa2: 2mha A:1-181 [38291]
    Other proteins in same PDB: d2mhaa1, d2mhab_, d2mhac1, d2mhad_

Details for d2mhaa2

PDB Entry: 2mha (more details), 2.5 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition
PDB Compounds: (A:) class I histocompatibility antigen (h-2kb) (alpha chain)

SCOPe Domain Sequences for d2mhaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhaa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d2mhaa2:

Click to download the PDB-style file with coordinates for d2mhaa2.
(The format of our PDB-style files is described here.)

Timeline for d2mhaa2: