Lineage for d6tdsc2 (6tds C:182-275)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366056Domain d6tdsc2: 6tds C:182-275 [382865]
    Other proteins in same PDB: d6tdsa1, d6tdsb1, d6tdsb2, d6tdsc1, d6tdsd1, d6tdsd2
    automated match to d1ogaa1
    complexed with cl, edo, na

Details for d6tdsc2

PDB Entry: 6tds (more details), 1.7 Å

PDB Description: crystal structure of the disulfide engineered hla-a0201 molecule without peptide bound after nacl wash
PDB Compounds: (C:) MHC class I antigen

SCOPe Domain Sequences for d6tdsc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tdsc2 b.1.1.0 (C:182-275) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwvavvvpsgqeqrytchvqheglpkpltlrwe

SCOPe Domain Coordinates for d6tdsc2:

Click to download the PDB-style file with coordinates for d6tdsc2.
(The format of our PDB-style files is described here.)

Timeline for d6tdsc2: