Lineage for d6juwy_ (6juw Y:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025361Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) (S)
    automatically mapped to Pfam PF02935
  5. 3025362Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)
  6. 3025461Protein automated matches [191231] (1 species)
    not a true protein
  7. 3025462Species Cow (Bos taurus) [TaxId:9913] [189652] (7 PDB entries)
  8. 3025468Domain d6juwy_: 6juw Y: [382842]
    Other proteins in same PDB: d6juwa_, d6juwb1, d6juwb2, d6juwc_, d6juwd_, d6juwe_, d6juwf_, d6juwg_, d6juwh_, d6juwi_, d6juwj_, d6juwk_, d6juwm_, d6juwn_, d6juwo1, d6juwo2, d6juwp_, d6juwq_, d6juwr_, d6juws_, d6juwt_, d6juwu_, d6juwv_, d6juww_, d6juwx_, d6juwz_
    automated match to d2occl_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d6juwy_

PDB Entry: 6juw (more details), 1.8 Å

PDB Description: bovine heart cytochrome c oxidase in catalitic intermediates at 1.80 angstrom resolution
PDB Compounds: (Y:) cytochrome c oxidase subunit 7c, mitochondrial

SCOPe Domain Sequences for d6juwy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6juwy_ f.23.6.1 (Y:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOPe Domain Coordinates for d6juwy_:

Click to download the PDB-style file with coordinates for d6juwy_.
(The format of our PDB-style files is described here.)

Timeline for d6juwy_: