Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species) |
Species Human (Homo sapiens), HLA-E [TaxId:9606] [54479] (4 PDB entries) |
Domain d1mhea2: 1mhe A:2-181 [38275] Other proteins in same PDB: d1mhea1, d1mheb_, d1mhec1, d1mhed_ |
PDB Entry: 1mhe (more details), 2.85 Å
SCOP Domain Sequences for d1mhea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhea2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-E [TaxId: 9606]} shslkyfhtsvsrpgrgeprfisvgyvddtqfvrfdndaasprmvprapwmeqegseywd retrsardtaqifrvnlrtlrgyynqseagshtlqwmhgcelgpdrrflrgyeqfaydgk dyltlnedlrswtavdtaaqiseqksndaseaehqrayledtcvewlhkylekgketllh
Timeline for d1mhea2:
View in 3D Domains from other chains: (mouse over for more information) d1mheb_, d1mhec1, d1mhec2, d1mhed_ |