Lineage for d6juwo2 (6juw O:91-227)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2366998Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2366999Protein Cytochrome c oxidase [49544] (4 species)
  7. 2367000Species Cow (Bos taurus) [TaxId:9913] [49545] (44 PDB entries)
  8. 3082663Domain d6juwo2: 6juw O:91-227 [382725]
    Other proteins in same PDB: d6juwa_, d6juwb1, d6juwc_, d6juwd_, d6juwe_, d6juwf_, d6juwg_, d6juwh_, d6juwi_, d6juwj_, d6juwk_, d6juwl_, d6juwm_, d6juwn_, d6juwo1, d6juwp_, d6juwq_, d6juwr_, d6juws_, d6juwt_, d6juwu_, d6juwv_, d6juww_, d6juwx_, d6juwy_, d6juwz_
    automated match to d1v54b1
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d6juwo2

PDB Entry: 6juw (more details), 1.8 Å

PDB Description: bovine heart cytochrome c oxidase in catalitic intermediates at 1.80 angstrom resolution
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6juwo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6juwo2 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d6juwo2:

Click to download the PDB-style file with coordinates for d6juwo2.
(The format of our PDB-style files is described here.)

Timeline for d6juwo2: