Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) automatically mapped to Pfam PF02284 |
Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
Protein automated matches [254653] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255695] (7 PDB entries) |
Domain d6juwr_: 6juw R: [382643] Other proteins in same PDB: d6juwa_, d6juwb1, d6juwb2, d6juwc_, d6juwd_, d6juwf_, d6juwg_, d6juwh_, d6juwi_, d6juwj_, d6juwk_, d6juwl_, d6juwm_, d6juwn_, d6juwo1, d6juwo2, d6juwp_, d6juwq_, d6juws_, d6juwt_, d6juwu_, d6juwv_, d6juww_, d6juwx_, d6juwy_, d6juwz_ automated match to d1ocre_ complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn |
PDB Entry: 6juw (more details), 1.8 Å
SCOPe Domain Sequences for d6juwr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6juwr_ a.118.11.1 (R:) automated matches {Cow (Bos taurus) [TaxId: 9913]} hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d6juwr_:
View in 3D Domains from other chains: (mouse over for more information) d6juwa_, d6juwb1, d6juwb2, d6juwc_, d6juwd_, d6juwe_, d6juwf_, d6juwg_, d6juwh_, d6juwi_, d6juwj_, d6juwk_, d6juwl_, d6juwm_, d6juwn_, d6juwo1, d6juwo2, d6juwp_, d6juwq_, d6juws_, d6juwt_, d6juwu_, d6juwv_, d6juww_, d6juwx_, d6juwy_, d6juwz_ |