Lineage for d6tcpc2 (6tcp C:111-216)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2362734Domain d6tcpc2: 6tcp C:111-216 [382552]
    Other proteins in same PDB: d6tcpa1, d6tcpc1, d6tcpe1, d6tcpl1
    automated match to d1dn0a2
    complexed with gol, peg, so4; mutant

Details for d6tcpc2

PDB Entry: 6tcp (more details), 2.5 Å

PDB Description: crystal structure of the omalizumab fab leu158pro light chain mutant - crystal form ii
PDB Compounds: (C:) Omalizumab Fab Leu158Pro light chain mutant

SCOPe Domain Sequences for d6tcpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tcpc2 b.1.1.2 (C:111-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnapqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d6tcpc2:

Click to download the PDB-style file with coordinates for d6tcpc2.
(The format of our PDB-style files is described here.)

Timeline for d6tcpc2: