SCOPe 2.07: Domain d6w4ba_: 6w4b A:

Lineage for d6w4ba_ (6w4b A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.140: Replicase NSP9 [101815] (1 superfamily)
   barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel

4. Superfamily b.140.1: Replicase NSP9 [101816] (2 families)

5. Family b.140.1.1: Replicase NSP9 [101817] (2 proteins)
   automatically mapped to Pfam PF08710

6. Protein automated matches [191025] (2 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382506] (4 PDB entries)

8. Domain d6w4ba_: 6w4b A: [382545]
   automated match to d1qz8a_

Details for d6w4ba_

PDB Entry: 6w4b, 2.95 Å

PDB Description: the crystal structure of nsp9 rna binding protein of sars cov-2

PDB Compounds: (A:) Nsp9 replicase protein

SCOPe Domain Sequences for d6w4ba_:

Sequence; same for both SEQRES and ATOM records:

>d6w4ba_ b.140.1.1 (A:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
spvalrqmscaagttqtactddnalayynttkggrfvlallsdlqdlkwarfpksdgtgt
iyteleppcrfvtdtpkgpkvkylyfikglnnlnrgmvlgslaatvrlq

Timeline for d6w4ba_:

• d6w4ba_ is new in SCOPe 2.07-stable
  
• d6w4ba_ appears in the current release, SCOPe 2.08