Lineage for d6vgke_ (6vgk E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2462272Species Mycobacterium tuberculosis [TaxId:1773] [189677] (9 PDB entries)
  8. 2462293Domain d6vgke_: 6vgk E: [382489]
    automated match to d5e0sb_

Details for d6vgke_

PDB Entry: 6vgk (more details), 3.1 Å

PDB Description: clpp1p2 complex from m. tuberculosis
PDB Compounds: (E:) ATP-dependent Clp protease proteolytic subunit 2

SCOPe Domain Sequences for d6vgke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vgke_ c.14.1.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
snpynklfeeriiflgvqvddasandimaqllvlesldpdrditmyinspgggftslmai
ydtmqyvradiqtvclgqaasaaavllaagtpgkrmalpnarvlihqpslsgviqgqfsd
leiqaaeiermrtlmettlarhtgkdagvirkdtdrdkiltaeeakdygiidtvleyrkl
s

SCOPe Domain Coordinates for d6vgke_:

Click to download the PDB-style file with coordinates for d6vgke_.
(The format of our PDB-style files is described here.)

Timeline for d6vgke_: