Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (70 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [189677] (9 PDB entries) |
Domain d6vgke_: 6vgk E: [382489] automated match to d5e0sb_ |
PDB Entry: 6vgk (more details), 3.1 Å
SCOPe Domain Sequences for d6vgke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vgke_ c.14.1.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} snpynklfeeriiflgvqvddasandimaqllvlesldpdrditmyinspgggftslmai ydtmqyvradiqtvclgqaasaaavllaagtpgkrmalpnarvlihqpslsgviqgqfsd leiqaaeiermrtlmettlarhtgkdagvirkdtdrdkiltaeeakdygiidtvleyrkl s
Timeline for d6vgke_: