Lineage for d6qu9l1 (6qu9 L:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370175Domain d6qu9l1: 6qu9 L:1-107 [382432]
    Other proteins in same PDB: d6qu9b2, d6qu9l2
    automated match to d2fd6l1
    complexed with gol, na, so4

Details for d6qu9l1

PDB Entry: 6qu9 (more details), 1.9 Å

PDB Description: fab fragment of an antibody that inhibits polymerisation of alpha-1- antitrypsin
PDB Compounds: (L:) FAB 4B12 light chain

SCOPe Domain Sequences for d6qu9l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qu9l1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqtpsslsaslggkvtitckasqkinnyiawyqlkpgkgprqlihytsklqpgips
rfsgsgsgsdysfsisnlepedigtyyclryedlwtfgggtkleik

SCOPe Domain Coordinates for d6qu9l1:

Click to download the PDB-style file with coordinates for d6qu9l1.
(The format of our PDB-style files is described here.)

Timeline for d6qu9l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6qu9l2