SCOPe 2.07: Domain d6y6ha1: 6y6h A:25-309

Lineage for d6y6ha1 (6y6h A:25-309)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)

8. Domain d6y6ha1: 6y6h A:25-309 [382263]
   Other proteins in same PDB: d6y6ha2
   automated match to d2ycra_
   complexed with edo, obw

Details for d6y6ha1

PDB Entry: 6y6h, 1.95 Å

PDB Description: crystal structure of stk17b (drak2) in complex with unc-ap-194 probe

PDB Compounds: (A:) Serine/threonine-protein kinase 17B

SCOPe Domain Sequences for d6y6ha1:

Sequence; same for both SEQRES and ATOM records:

>d6y6ha1 d.144.1.0 (A:25-309) automated matches {Human (Homo sapiens) [TaxId: 9606]}
menfnnfyiltskelgrgkfavvrqciskstgqeyaakflkkrrrgqdcraeilheiavl
elakscprvinlhevyentseiilileyaaggeifslclpelaemvsendvirlikqile
gvyylhqnnivhldlkpqnillssiyplgdikivdfgmsrkighacelreimgtpeylap
eilnydpittatdmwnigiiaymllthtspfvgednqetylnisqvnvdyseetfssvsq
latdfiqsllvknpekrptaeiclshswlqqwdfenlfhpeetss

Timeline for d6y6ha1:

• d6y6ha1 is new in SCOPe 2.07-stable
  
• d6y6ha1 appears in the current release, SCOPe 2.08