SCOPe 2.07: Domain d6vjea1: 6vje A:50-221

Lineage for d6vjea1 (6vje A:50-221)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (13 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [234430] (7 PDB entries)

8. Domain d6vjea1: 6vje A:50-221 [382225]
   Other proteins in same PDB: d6vjea2
   automated match to d4weka1
   complexed with cl, rb6

Details for d6vjea1

PDB Entry: 6vje, 1.76 Å

PDB Description: crystal structure of pseudomonas aeruginosa penicillin-binding protein 3 (pbp3) complexed with ceftobiprole

PDB Compounds: (A:) Peptidoglycan D,D-transpeptidase FtsI

SCOPe Domain Sequences for d6vjea1:

Sequence; same for both SEQRES and ATOM records:

>d6vjea1 d.175.1.0 (A:50-221) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
arsvrhiaipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtkl
fadrieqnaerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftd
vddrgregielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

Timeline for d6vjea1:

• d6vjea1 is new in SCOPe 2.07-stable
  
• d6vjea1 appears in the current release, SCOPe 2.08