Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily) unusual fold |
Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) automatically mapped to Pfam PF03717 |
Family d.175.1.0: automated matches [227232] (1 protein) not a true family |
Protein automated matches [226981] (13 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [234430] (7 PDB entries) |
Domain d6vjea1: 6vje A:50-221 [382225] Other proteins in same PDB: d6vjea2 automated match to d4weka1 complexed with cl, rb6 |
PDB Entry: 6vje (more details), 1.76 Å
SCOPe Domain Sequences for d6vjea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vjea1 d.175.1.0 (A:50-221) automated matches {Pseudomonas aeruginosa [TaxId: 287]} arsvrhiaipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtkl fadrieqnaerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftd vddrgregielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal
Timeline for d6vjea1: