Lineage for d6rlya1 (6rly A:106-263)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) Protein Macrophage elastase (MMP-12) [69780] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
Uniprot P39900 106-263 ! Uniprot P39900 106-264
Domain d6rlya1: 6rly A:106-263 [382144]
Other proteins in same PDB: d6rlya2
automated match to d5i43b_
complexed with ca, hae, k8t, zn
Details for d6rlya1
PDB Entry: 6rly (more details), 2.2 Å
PDB Description: human mmp12 (catalytic domain) in complex with ap316
PDB Compounds: (A:) Macrophage metalloelastaseSCOPe Domain Sequences for d6rlya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rlya1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg
SCOPe Domain Coordinates for d6rlya1:
Click to download the PDB-style file with coordinates for d6rlya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6rlya1:
- d6rlya1 is new in SCOPe 2.07-stable
- d6rlya1 appears in the current release, SCOPe 2.08
View in 3D
