Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily) 2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix |
Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (2 families) |
Family e.37.1.0: automated matches [381345] (1 protein) not a true family |
Protein automated matches [381346] (1 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [381347] (9 PDB entries) |
Domain d6ulua2: 6ulu A:114-215 [382039] Other proteins in same PDB: d6ulua1, d6ulua3, d6ulub1, d6ulub3 automated match to d1pjqa3 complexed with cl, sah |
PDB Entry: 6ulu (more details), 2.76 Å
SCOPe Domain Sequences for d6ulua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ulua2 e.37.1.0 (A:114-215) automated matches {Salmonella typhimurium [TaxId: 90371]} psiidrsplmvavsaggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmg errrfwekffvndrlaqslanadekavnatterlfsepldhr
Timeline for d6ulua2: