Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries) |
Domain d6tiwa2: 6tiw A:246-438 [381939] Other proteins in same PDB: d6tiwa1, d6tiwb1 automated match to d4i50a2 complexed with g2p, mg, mzk |
PDB Entry: 6tiw (more details), 1.09 Å
SCOPe Domain Sequences for d6tiwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tiwa2 d.79.2.1 (A:246-438) automated matches {Pig (Sus scrofa) [TaxId: 9823]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvd
Timeline for d6tiwa2: