SCOPe 2.07: Domain d6tiwa2: 6tiw A:246-438

Lineage for d6tiwa2 (6tiw A:246-438)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries)

8. Domain d6tiwa2: 6tiw A:246-438 [381939]
   Other proteins in same PDB: d6tiwa1, d6tiwb1
   automated match to d4i50a2
   complexed with g2p, mg, mzk

Details for d6tiwa2

PDB Entry: 6tiw, 1.09 Å

PDB Description: human kinesin-5 motor domain in the gsk state bound to microtubules (conformation 2)

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6tiwa2:

Sequence; same for both SEQRES and ATOM records:

>d6tiwa2 d.79.2.1 (A:246-438) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvd

Timeline for d6tiwa2:

• d6tiwa2 is new in SCOPe 2.07-stable
  
• d6tiwa2 appears in the current release, SCOPe 2.08