Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Alopecurus myosuroides [TaxId:81473] [381852] (1 PDB entry) |
Domain d6riva1: 6riv A:1-84 [381865] Other proteins in same PDB: d6riva2, d6rivb2 automated match to d1axda2 complexed with gol, gs8, na, sin |
PDB Entry: 6riv (more details), 1.33 Å
SCOPe Domain Sequences for d6riva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6riva1 c.47.1.0 (A:1-84) automated matches {Alopecurus myosuroides [TaxId: 81473]} mapvkvfgpamstnvarvtlcleevgaeyevvnidfntmehkspehlarnpfgqipafqd gdlllwesraiskyvlrkyktdev
Timeline for d6riva1: