Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (26 species) not a true protein |
Species Trypanosoma cruzi [TaxId:353153] [226636] (7 PDB entries) |
Domain d6jkse1: 6jks E:3-157 [381772] Other proteins in same PDB: d6jksb3, d6jksc3, d6jksd3, d6jksf3 automated match to d4iv5d1 complexed with asp, cp |
PDB Entry: 6jks (more details), 2.1 Å
SCOPe Domain Sequences for d6jkse1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jkse1 c.78.1.0 (E:3-157) automated matches {Trypanosoma cruzi [TaxId: 353153]} elppvaslkgksitsaeqfsradiyalihlasamqrkidagevlnllqgrimtplffeds srtfssfcaamirlggsvvnfkveassinkgetladtirtldsysdvlvmrhprqdaiee alsvaqhpilnagngagehptqalldtltihselg
Timeline for d6jkse1: