Lineage for d6jy8a_ (6jy8 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2628564Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2628565Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2628891Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 2628892Protein automated matches [226845] (23 species)
    not a true protein
  7. 2629001Species Nonlabens marinus [TaxId:1454201] [319523] (29 PDB entries)
  8. 2629024Domain d6jy8a_: 6jy8 A: [381671]
    automated match to d5g28a_
    complexed with cl, ola, ret

Details for d6jy8a_

PDB Entry: 6jy8 (more details), 1.9 Å

PDB Description: structure of dark-state marine bacterial chloride importer, nm-r3, with cw laser (nd-3%) at 95k.
PDB Compounds: (A:) Chloride pumping rhodopsin

SCOPe Domain Sequences for d6jy8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jy8a_ f.13.1.0 (A:) automated matches {Nonlabens marinus [TaxId: 1454201]}
knieslfdysagqfefidhlltmgvgvhfaalifflvvsqfvapkyriatalscivmvsa
glilnsqavmwtdayayvdgsyqlqdltfsngyryvnwmatipclllqllivlnlkgkel
fstatwlilaawgmiitgyvgqlyevddiaqlmiwgavstaffvvmnwivgtkifknrat
mlggtdstitkvfwlmmfawtlypiaylvpafmnnadgvvlrqllftiadisskviyglm
ityiaiqqsaaagyvpaqqalgri

SCOPe Domain Coordinates for d6jy8a_:

Click to download the PDB-style file with coordinates for d6jy8a_.
(The format of our PDB-style files is described here.)

Timeline for d6jy8a_: