Lineage for d1hdmb2 (1hdm B:3-87)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938368Species Human (Homo sapiens), HLA-DM [TaxId:9606] [88820] (1 PDB entry)
  8. 2938369Domain d1hdmb2: 1hdm B:3-87 [38158]
    Other proteins in same PDB: d1hdma1, d1hdma2, d1hdmb1
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1hdmb2

PDB Entry: 1hdm (more details), 2.5 Å

PDB Description: histocompatibility antigen hla-dm
PDB Compounds: (B:) protein (class II histocompatibility antigen, m beta chain)

SCOPe Domain Sequences for d1hdmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdmb2 d.19.1.1 (B:3-87) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]}
fvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapcnslanvlsqhlnqkdt
lmqrlnglqncathtqpfwgsltnr

SCOPe Domain Coordinates for d1hdmb2:

Click to download the PDB-style file with coordinates for d1hdmb2.
(The format of our PDB-style files is described here.)

Timeline for d1hdmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hdmb1