SCOPe 2.08: Domain d1hdma2: 1hdm A:13-93

Lineage for d1hdma2 (1hdm A:13-93)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DM [TaxId:9606] [88807] (1 PDB entry)

8. Domain d1hdma2: 1hdm A:13-93 [38157]
   Other proteins in same PDB: d1hdma1, d1hdmb1, d1hdmb2
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1hdma2

PDB Entry: 1hdm, 2.5 Å

PDB Description: histocompatibility antigen hla-dm

PDB Compounds: (A:) protein (class II histocompatibility antigen, m alpha chain)

SCOPe Domain Sequences for d1hdma2:

Sequence; same for both SEQRES and ATOM records:

>d1hdma2 d.19.1.1 (A:13-93) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]}
lqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefadwaqeqgdailf
dkefcewmiqqipkldgkipv

Timeline for d1hdma2:

• d1hdma2 first appeared (with stable ids) in SCOP 1.55
  
• d1hdma2 appears in SCOPe 2.07