Lineage for d6pr4a2 (6pr4 A:114-215)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2625759Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily)
    2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix
  4. 2625760Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (2 families) (S)
  5. 2625782Family e.37.1.0: automated matches [381345] (1 protein)
    not a true family
  6. 2625783Protein automated matches [381346] (1 species)
    not a true protein
  7. 2625784Species Salmonella typhimurium [TaxId:90371] [381347] (9 PDB entries)
  8. 2625795Domain d6pr4a2: 6pr4 A:114-215 [381533]
    Other proteins in same PDB: d6pr4a1, d6pr4a3, d6pr4b1, d6pr4b3
    automated match to d1pjqa3
    complexed with sah

Details for d6pr4a2

PDB Entry: 6pr4 (more details), 2.24 Å

PDB Description: d262n/s128a s. typhimurium siroheme synthase
PDB Compounds: (A:) Siroheme synthase

SCOPe Domain Sequences for d6pr4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pr4a2 e.37.1.0 (A:114-215) automated matches {Salmonella typhimurium [TaxId: 90371]}
psiidrsplmvavsaggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmg
errrfwekffvndrlaqslanadekavnatterlfsepldhr

SCOPe Domain Coordinates for d6pr4a2:

Click to download the PDB-style file with coordinates for d6pr4a2.
(The format of our PDB-style files is described here.)

Timeline for d6pr4a2: